Gordonia sp. 135: GKZ92_14970 Help Entry GKZ92_14970       CDS       T06305                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism god  Gordonia sp. 135 Pathway god01100   Metabolic pathways god01110   Biosynthesis of secondary metabolites Module god_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:god00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GKZ92_14970    00074 Mycolic acid biosynthesis     GKZ92_14970   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GKZ92_14970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QGP88822 LinkDB All DBs Position 3312984..3313286 Genome browser AA seq 100 aa AA seqDB search MAATQEQLIAGIAEIIEEVTGIEPSEVTMEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP DEDLAGLRTVGDAVSYIQKLESENPEAAAAIKAQVEADQN NT seq 303 nt NT seq  +upstreamnt  +downstreamnt gtggctgccacccaggaacaactcattgccggcatcgccgagatcatcgaggaagtcacc ggcatcgagccgtccgaggtgacgatggagaagtcgttcgtcgacgatctggacatcgac tcgctgtccatggtcgagatcgcggtgcagaccgaggacaagtacggcgtgaagatcccc gatgaggacctcgccggtctgcgcaccgtcggcgacgccgtctcgtacatccagaagctc gagagcgagaaccccgaggctgcggctgccatcaaagcccaggtcgaggcagaccagaac tga

DBGET integrated database retrieval system