KEGG   Gluconobacter oxydans H24: B932_0849
Entry
B932_0849         CDS       T02348                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
goh  Gluconobacter oxydans H24
Brite
KEGG Orthology (KO) [BR:goh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:goh02000]
    B932_0849
Transporters [BR:goh02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    B932_0849
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_16 AAA_21 AAA_22 AAA_18 AAA AAA_5 ABC_ATPase AAA_28 Mg_chelatase DEAD AAA_30 AAA_29 AAA_24 RsgA_GTPase AAA_25 TsaE AAA_33 PduV-EutP nSTAND3 G-alpha AAA_14 NACHT AAA_15
Other DBs
NCBI-ProteinID: AFW00444
LinkDB
Position
complement(877574..879412)
AA seq 612 aa
MSDTSTHLTGQKQEGRKIDVSFTEVLSFVCRRWLAHPALLAWTLSGVALATLADVVTPIL
AGRLVSDISKHAAGPTIPKTDELLSLRNDAFLMVGGLIALGLIGLYGRRSSFVGISHLTL
SIMHKVLNQAFERVQRFSTDWHANTFAGSTVRRLTRGMWAIDTLDDTLLLMIGPEVMVLG
GTTAVLMFRSPLMGSVLAVSVVLFAWLSITLTLRYVAPSARASNEWDTKMGASIADSVTC
NPVVKAFGAELREEKRLDTIVQGWRERTLRTWLRGTNSANIQALASLVMRMLMIGLAVML
WWQGKAGPGDVAYVLTMMFLVQGYLRDLGQQVSQVQRSVNEMEELIAIFRRDSAIQDAPD
AEKARFTQGEIHFEHVTFQYPGQEKPLYQDLNIDIAPGSRVALVGPSGSGKTTLTKLLQR
LYDVNSGRIAVDGQDIAQVTQSSLRSHIAIVPQEPVLFHRTLAENIAYARPGASLDEIKE
AARQANAAAFIERLPEGYNTMVGERGVKLSGGERQRVAIARAFLADAPILIFDEATSSLD
SESESLVQEAMRRLMKNRTVIVVAHRLSTVMELDRILVFSRGELKEDGTHAELVAKDGGI
YRRLFELQSLEG
NT seq 1839 nt   +upstreamnt  +downstreamnt
gtgtccgatacttctacgcaccttaccggccagaaacaggaaggccggaaaattgacgtt
tcctttacagaagtcctgtcctttgtctgccgccgctggctggcgcatccggccttgctg
gcctggacactgtccggtgtggcgctcgctacactggccgatgtcgtcacaccgattctg
gcaggtcgcctcgtctcggatatttccaaacacgctgccgggccgaccattcccaaaacc
gatgagcttctgagcctgcgcaacgatgccttcctgatggttggtggcttaatcgctctg
ggtctgatcggcctgtacgggcgtcgatcctctttcgtcggtatttcgcatcttacgctt
tcgatcatgcacaaggtgctcaatcaggctttcgagcgggtgcagcggttctccacagac
tggcacgccaacacctttgccggttcaacagtgcgtcggctgacccgtggcatgtgggcg
attgatacgctggacgacacgcttctgctgatgatcggcccggaagtcatggttctcggc
ggtacaacggccgtcctcatgttccgctcgcctctcatgggctccgttctggcggtgtcc
gtcgttctgttcgcatggctctctattaccctgacgctccgttacgttgcgcccagcgcc
cgtgcctcgaacgagtgggacaccaagatgggggcctccattgcggattccgtgacctgt
aatccggtcgtcaaagccttcggtgcggaactgcgcgaggaaaagcggctggacaccatc
gttcagggctggcgggagcgcacgctccgcacatggctgcggggaaccaacagtgccaac
attcaggcgctggcgtctctcgtgatgcggatgctcatgatcggtctggccgtcatgctc
tggtggcagggcaaggccggtccgggtgatgtggcctatgtgctgaccatgatgttcctc
gtgcagggctatctgcgtgatctggggcagcaggtcagtcaggtgcagcgttccgtcaac
gagatggaagaactgattgccattttccgccgtgattccgccattcaggacgcgcccgat
gcggaaaaggcccggttcacacagggtgagatccacttcgaacacgtcaccttccagtat
ccggggcaggaaaagccgctttatcaggatctcaacattgatattgcacccggctcacgc
gtggccctcgttggacccagcgggtcaggcaagaccactctaaccaagctgcttcagcgc
ctgtatgacgtgaacagcgggcgcatcgccgtggacggtcaggatattgcacaggtcacg
cagtcttccctgcggtctcacatcgccatcgtgccccaggagccggtgctttttcaccgt
acactggcggaaaacattgcctatgcccggcccggcgcatctctggatgagatcaaggaa
gcagcccgtcaggccaatgcggcggctttcattgaacgtctgccggaaggctacaatacg
atggtcggtgagcgcggtgtgaagctgtctggcggcgagcgtcagcgtgtcgccattgcc
cgtgctttcctcgctgatgcgccgatcctgatcttcgatgaagcgacctccagccttgat
tcggaatcggaatctctcgtgcaggaggccatgcgccgcctcatgaaaaaccggaccgtc
atcgtcgtggcgcatcgtctttctaccgtcatggaactggatcgaattctggtcttcagc
cgtggcgaactgaaggaagacggcacccatgccgaactcgtggcaaaagacggaggtatc
tatcgccgcctgttcgaacttcagtcgctcgaaggctga

DBGET integrated database retrieval system