Gluconobacter oxydans H24: B932_3478 Help Entry B932_3478         CDS       T02348                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism goh  Gluconobacter oxydans H24 Pathway goh01100   Metabolic pathways goh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:goh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B932_3478    00074 Mycolic acid biosynthesis     B932_3478   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B932_3478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AFW03017 LinkDB All DBs Position complement(3534796..3535035) Genome browser AA seq 79 aa AA seqDB search MSDIADKVKKIVVEHLGVEESKVTPEASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgacaaggtgaagaagatcgttgtcgagcacctcggcgttgaagaa agcaaggtcacgccggaagcgtctttcattgacgatctgggcgcagacagcctcgacacc gtcgagctggtcatggctttcgaagaagctttctccgtcgagatcccggaagatgcagct gagaagatcgccaccgtcaaggacgcgattgactacatcgaaaagcagaaggctgcctga

DBGET integrated database retrieval system