KEGG   Gordonia otitidis: LK459_03685
Entry
LK459_03685       CDS       T07915                                 
Name
(GenBank) TauD/TfdA family dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
goi  Gordonia otitidis
Pathway
goi00430  Taurine and hypotaurine metabolism
goi00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:goi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    LK459_03685
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LK459_03685
Enzymes [BR:goi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     LK459_03685
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: UEA59999
LinkDB
Position
complement(825998..826918)
AA seq 306 aa
MTISLPDSPRTPADSGFGDVAPVSSGVEFDIDEFGPRFGAEIRGVDVASASDDEIRAIRS
ALIDYKVIVLRDQHLDDASHVEFGRRIGDLTAGHPVWNSGDVPAEVYSLDSTDNGFADVW
HTDVTFMPRPPMGSILRPVVLPRNGGDTNWADAELAYESLSKPVQRLVDDLTASHDGNRE
FGYYLQQRRGGRGNVWDGKEVTELVPVSHPVVRVHPETGRKSLFVNPGFTSHIEGVSDAE
SRGILDLLYAHLTKPEHIVRHRWRLGDLVLWDNRNTLHYANRDYGDTRRVMHRITLRGDA
PVGPSR
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaccatttcactccctgattccccacgcacgccggccgactccgggttcggcgatgtt
gccccggtctcgtccggtgtcgagttcgacatcgacgagttcggccctcgattcggtgcc
gagatccgcggcgtcgacgtcgcctcagcctcggacgacgagatccgcgcaattcgctcg
gcgctgatcgattacaaggtgatcgtgctccgcgatcagcacctcgacgacgcgtcgcac
gtcgagttcgggcgccgcatcggcgatctcaccgcgggacaccccgtgtggaacagtggc
gacgtccctgccgaggtgtattcgctcgacagcaccgacaacgggttcgccgacgtctgg
cacaccgacgtgacgttcatgccgcgaccgccgatgggatcgatcctgcgtccggtcgtg
ttgccgcgcaacggaggcgacaccaactgggccgatgccgagctggcctacgagtcgctg
tcgaagccggtgcaacgactcgtcgacgatctcaccgcgagtcacgacggtaatcgcgag
ttcggctactacctccagcagcgtcgcggtggccgcggaaacgtgtgggacggtaaagaa
gtcaccgaactcgttccggtgtcgcaccccgtcgtgcgggtccacccggagacgggccga
aagtcgctgttcgtcaacccgggcttcacatcccacatcgagggcgtgtcggacgccgag
agccggggcatcctcgacctcctctacgcgcatctgacgaagccggaacacattgtgcga
caccgctggcgtctcggcgacctggtgctgtgggacaaccgcaacaccctgcactacgcc
aaccgcgactacggcgacactcgcagagtgatgcaccgcatcactctgcgaggtgacgcg
ccggtggggccgtcgaggtaa

DBGET integrated database retrieval system