Gordonia insulae: D7316_00582
Help
Entry
D7316_00582 CDS
T05722
Symbol
coaD
Name
(GenBank) Phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
gom
Gordonia insulae
Pathway
gom00770
Pantothenate and CoA biosynthesis
gom01100
Metabolic pathways
gom01240
Biosynthesis of cofactors
Module
gom_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
gom00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
D7316_00582 (coaD)
Enzymes [BR:
gom01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
D7316_00582 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
ATP-sulfurylase
Motif
Other DBs
NCBI-ProteinID:
AZG44002
UniProt:
A0A3G8JHL2
LinkDB
All DBs
Position
610437..610925
Genome browser
AA seq
162 aa
AA seq
DB search
MTSAVFPGSFDPFTVGHRYIVERAAARFDSLVVTVVVNPNKHGLFAVDERIALIREECAD
LPNVRVDRWTGLLVDYLRNENIDTIVKGLRSGTDFDYEVPMAQMNRDLTDVETMFLLTDP
RYAHVSSSLVKEVAKLGGDVVPFLSPHIHERLQAILAGERQI
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgacctcagccgtcttccccggatccttcgacccgttcaccgtcggtcaccgctacatc
gtggagcgcgccgccgcgcgcttcgactcgctggtcgtcaccgtggtggtcaacccgaac
aagcacggactgttcgccgtcgacgagcgcatcgcgctcatccgcgaggagtgtgcggac
ctgcccaacgtccgggtcgaccgctggaccggtctgctcgtcgactatctgcgcaacgag
aacatcgacaccatcgtcaaaggtctccggtcggggaccgacttcgactacgaggtgccg
atggcgcagatgaaccgcgacctcaccgacgtcgagaccatgttcctgctcaccgacccg
cgctatgcccacgtgtcgagctcgctggtcaaggaggtggcgaagctcggtggtgacgtc
gtgccgttcctgtcgccgcacatccacgagcgcctgcaggcgattctcgccggcgaacga
cagatctga
DBGET
integrated database retrieval system