Gordonia sp. X0973: HUN08_07255
Help
Entry
HUN08_07255 CDS
T10819
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
goo Gordonia sp. X0973
Pathway
goo00770
Pantothenate and CoA biosynthesis
goo01100
Metabolic pathways
goo01240
Biosynthesis of cofactors
Module
goo_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
goo00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
HUN08_07255 (coaD)
Enzymes [BR:
goo01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
HUN08_07255 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID:
QKT07011
LinkDB
All DBs
Position
1474807..1475295
Genome browser
AA seq
162 aa
AA seq
DB search
MSIALCPGSFDPFTLGHRFVVERAAARFDEVVVTVVVNPNKQGMFTVDERIDLISSTCAD
LPNVRVDRWRGLLVDYMRNEGITTMVKGLRSTVDFEYEVPMAQMNRELADVETLFLWGDP
KFAHVSSSLVKEVAKLGGDVEPFLPPDVFAAVMRKVNGELSV
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgagcatcgcattgtgcccgggttccttcgatccgttcactctcggccaccgcttcgtc
gtcgagcgggccgccgcccgcttcgacgaggtggtcgtcaccgtcgtcgtcaatccgaat
aagcaggggatgttcaccgtcgacgaacggatcgacctgatctcgtcgacatgcgccgat
ctgccgaatgtgcgcgtggaccgctggcgcggcctgctggtggattacatgcgcaacgag
ggcatcacgacgatggtcaagggactgcgatccaccgtcgacttcgaatacgaggtgccg
atggcacagatgaaccgagagctcgccgacgtcgagacgctcttcctgtggggagatccg
aagttcgcgcacgtgtccagttcactggtgaaggaggtggcgaagctcggcggcgacgtg
gagccgttcctgccgcccgacgtctttgccgccgtgatgcggaaggtcaatggcgaactg
agcgtgtag
DBGET
integrated database retrieval system