KEGG   Gordonia sp. KTR9: KTR9_1289
Entry
KTR9_1289         CDS       T02216                                 
Name
(GenBank) putative taurine catabolism dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00430  Taurine and hypotaurine metabolism
gor00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KTR9_1289
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KTR9_1289
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     KTR9_1289
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AFR47929
LinkDB
Position
1464636..1465559
AA seq 307 aa
MTTTSQSVGSTPRPDTALRPDTGTISGGVEFDVDEFGPHFGAEIRGVDVATASDAQIAAL
RRALIDYKVIVLRDQHLDDEAHIRFGNRLGDLTFGHPVWNSGDVPGEVYSLDSADNGFAD
VWHTDVTFMPRPPMGSILRPVVLPRNGGDTNWADAELAYRSLSEPVRRMIDGLSAVHDGN
REFGYYLKQRRNGRGNTWDGEEVTELVPVTHPVVRIHPETGRKSLFVNPGFTSHIDGVSD
AESRGILDLLYAHLTKPEHIVRHRWRLGDLVLWDNRNTLHYANRDYGDARRVMHRITLRG
EAPIGPA
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacaaccacctcgcaatccgtcggctccacaccccgtcctgacacggcacttcgtccg
gacaccggaaccatctccggtggagtcgaattcgatgtcgacgagttcggtccgcacttc
ggtgccgagatccgcggcgtcgacgtggccacggcatccgacgcccagatcgccgcgctg
cgccgggcgctgatcgactacaaggtcatcgtcctccgcgatcagcacctcgacgacgag
gcgcacatccgattcggaaaccggctgggcgacctgaccttcgggcatccggtgtggaac
agcggcgacgtccccggtgaggtctactcactcgacagcgccgacaacggattcgccgat
gtctggcacaccgacgtcacgttcatgccgcgcccgccgatgggatcgatcctgcgtccg
gttgtgttgccgcgcaacggcggtgacaccaactgggcggacgccgaactcgcgtaccgg
tcgctgtcggagccggtccgccggatgatcgacggactcagtgcggtgcacgacggtaac
cgggagttcggttactacctcaagcagcgacgcaacggccgtggcaacacctgggacggc
gaagaggtcaccgagctggtgccggtcacccacccggtggtgcgcatccacccggagacc
ggccgcaagtcgttgttcgtcaatcccggattcacctcgcacatcgacggtgtctccgac
gcggagagccgcggcatcctggatctgctctacgcgcatctcaccaagcccgaacacatc
gtccggcaccgctggcgcctcggcgacctggtgctgtgggacaaccggaacacgctgcac
tacgcgaaccgcgactacggtgacgcccgccgtgtgatgcaccggatcaccctgcgcggt
gaggcacccatcgggccggcctga

DBGET integrated database retrieval system