KEGG   Gordonia sp. SMJS1: QAD21_18070
Entry
QAD21_18070       CDS       T10225                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
gos  Gordonia sp. SMJS1
Pathway
gos03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gos00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    QAD21_18070 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gos03011]
    QAD21_18070 (rplR)
Ribosome [BR:gos03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    QAD21_18070 (rplR)
  Bacteria
    QAD21_18070 (rplR)
  Archaea
    QAD21_18070 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p DUF6778
Other DBs
NCBI-ProteinID: WGJ84641
LinkDB
Position
complement(3926495..3926899)
AA seq 134 aa
MSDSATKTVRKPIGKDVSTRRRKATGNRHFRLRKKVSGTPARPRLAVKRSSRHIHVQLID
DLAGKTLAAASTIEADVRAAGGDKSAQARKVGELIAARAKAAGVDAVVFDRGGKDYHGRI
AALADAAREGGLSF
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagtgattcagctaccaagacagtgcgcaagccgatcggcaaggacgtctcgacgcgt
cgtcgcaaggcgaccggcaaccgtcacttccgcctccgcaagaaggtcagcggaaccccg
gcccgtccgcgtctcgcggtcaagcgcagctcgcgccacatccacgtccagttgatcgac
gacctggccggcaagacgctggccgcggcatcgacgatcgaggccgatgtgcgtgcggcc
ggcggcgacaagtccgcgcaggcccgcaaggtcggcgagctcatcgccgcccgcgccaag
gctgccggcgtcgacgccgtcgtgttcgaccgtggtggcaaggactaccacggccggatc
gccgcgctcgccgacgccgcccgcgagggaggcctgagcttctga

DBGET integrated database retrieval system