KEGG   Gemella sp. oral taxon 928: AXE85_00755
Entry
AXE85_00755       CDS       T04256                                 
Name
(GenBank) response regulator receiver protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
got  Gemella sp. oral taxon 928
Pathway
got02020  Two-component system
Brite
KEGG Orthology (KO) [BR:got00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXE85_00755
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    AXE85_00755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:got02022]
    AXE85_00755
   02035 Bacterial motility proteins [BR:got02035]
    AXE85_00755
Two-component system [BR:got02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   AXE85_00755
Bacterial motility proteins [BR:got02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AXE85_00755
SSDB
Motif
Pfam: Response_reg PDE8A_N GRDB
Other DBs
NCBI-ProteinID: AME08823
LinkDB
Position
172763..173131
AA seq 122 aa
MAKILIVDDSAYYRKRGAEIAKMAGFECYFAKNGKEAIEMFSKVKPDVVTMDICMPVLDG
LEATRIIHDLYPTKAKILICSSVGHVPTYKRQAFNNGAVGVLSKEYDIDDLEDALSEIEL
LK
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcaaaaatattgattgttgatgatagtgcatattatcgcaaacgtggtgcagaaata
gcaaagatggcaggttttgagtgttattttgctaaaaacggcaaagaggctatagaaatg
ttttctaaagtaaaaccggatgtagttacgatggatatttgtatgccggtattggatgga
ttagaagcaacacgtattatccatgatttatatcctacaaaagcgaaaatattgatttgt
agcagcgtaggtcatgttcctacatataaaagacaggcttttaataatggagcagtcgga
gttttatctaaggaatatgatattgatgatttggaagatgcgttatcagaaatagagtta
ttaaaataa

DBGET integrated database retrieval system