KEGG   Gemella sp. oral taxon 928: AXE85_01180
Entry
AXE85_01180       CDS       T04256                                 
Name
(GenBank) choline kinase
  KO
K25657  choline kinase [EC:2.7.1.32]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00552  Teichoic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00552 Teichoic acid biosynthesis
    AXE85_01180
Enzymes [BR:got01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AXE85_01180
SSDB
Motif
Pfam: Choline_kinase APH DUF1679
Other DBs
NCBI-ProteinID: AME08900
UniProt: A0A0X8KKQ8
LinkDB
Position
266400..267269
AA seq 289 aa
MKELIRDKISILLSPEEEIINVERLGGMTNNNYLVETTDKKYIVKFFGKGTEKLIDRKAE
KYNLELLQDLELDVKNYVFDIEAGIKVNKYIENAKTFDKNYIKTKLPSVAEILKTVHSSK
KELKGEFNPFSEILKYESLIIGKIYFPYYNKIREKVMSLKKPLEELGIQKKSCHIDLVPE
NFIEDEKGHIYLIDWEYSTMNDPMWDLAALFLESDFEKSEEGDFLRYYNSEKTPVSVGKI
LIYKILQDFIWSLWTIYKEEQGADFGTYGKDRYQRALKNLKEYVNSYEK
NT seq 870 nt   +upstreamnt  +downstreamnt
gtgaaagaattaatacgtgataaaataagtatattgttatctcctgaagaagaaataata
aatgtagaacgtttaggtggaatgaccaataacaattacctagtcgaaactacggataaa
aagtatattgttaaattttttgggaaaggtacagaaaaattaatagaccgtaaagctgaa
aaatataatttagagttgctgcaggacttggaactcgatgtgaaaaattatgtgtttgat
atagaagcaggaataaaagttaataaatatatagaaaatgccaaaactttcgataaaaat
tatataaaaacaaaattaccgagtgtagcggaaattttaaaaacagtgcatagttcaaaa
aaagagcttaaaggtgagtttaatccattttctgaaattttgaagtatgagagtttgata
atagggaaaatatatttcccttattataataaaataagagaaaaagtaatgtcgttgaaa
aaaccactagaagaattaggtatacaaaaaaaatcttgtcatattgatttagtaccagaa
aattttatagaagatgaaaaagggcacatttatctaatcgattgggaatattcaactatg
aatgatccaatgtgggatttagcagcgttatttttagaatctgattttgaaaaatcagaa
gaaggagattttctcaggtattataatagtgaaaaaacacctgttagtgttgggaaaata
ttgatttataaaatacttcaagattttatctggagtctttggacgatttataaagaagaa
caaggtgcagactttggtacatatggtaaagatagatatcaaagagcattaaaaaatttg
aaagagtatgtgaacagttatgaaaaataa

DBGET integrated database retrieval system