Gemella sp. oral taxon 928: AXE85_06175 Help Entry AXE85_06175       CDS       T04256                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism got  Gemella sp. oral taxon 928 Pathway got01100   Metabolic pathways got01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:got00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXE85_06175    00074 Mycolic acid biosynthesis     AXE85_06175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXE85_06175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Phage_TAC_1 PP-binding_2 Nop MinE Motif Other DBs NCBI-ProteinID:  AME09769 LinkDB All DBs Position complement(1337214..1337444) Genome browser AA seq 76 aa AA seqDB search MAIFEEVKDIIVKYIKIDKDKITLDSKLNEDLDADSIDIADVVMDIEEKYGFEFSDEDAE NITEIKDLVKVIEERK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaatttttgaagaagtaaaagatataattgttaaatatataaaaatagataaagat aaaataacattagattcaaaattaaatgaagatttagatgctgattcaattgatatagct gatgtagtaatggatattgaagaaaaatatggttttgaattttcggatgaagatgcagaa aatattacagaaatcaaagatttagtaaaagttattgaagaaagaaaataa

DBGET integrated database retrieval system