Gluconobacter oxydans 621H: GOX2041 Help Entry GOX2041           CDS       T00230                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gox  Gluconobacter oxydans 621H Pathway gox01100   Metabolic pathways gox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GOX2041    00074 Mycolic acid biosynthesis     GOX2041   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GOX2041 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AAW61777 UniProt:  Q5FPB9 LinkDB All DBs Position 2237277..2237516 Genome browser AA seq 79 aa AA seqDB search MSDIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgctgacaaggtaaagaagatcgttgtcgagcacctcggtgtggacgaa agcaaggtaacgccggacgcgtcgttcatcgacgacctgggcgctgacagcctcgacacg gtcgagctggtcatggctttcgaagaagccttctccgtcgagatcccggaagatgcagcc gagaagatcgcaaccgtcaaggatgccatcgactacatcgagaagcagaaggcagcctga

DBGET integrated database retrieval system