Gluconobacter oxydans DSM 3504: GLS_c11960 Help Entry GLS_c11960        CDS       T03563                                  Name (GenBank) putative DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism goy  Gluconobacter oxydans DSM 3504 Brite KEGG Orthology (KO) [BR:goy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:goy03032]     GLS_c11960    03036 Chromosome and associated proteins [BR:goy03036]     GLS_c11960    03400 DNA repair and recombination proteins [BR:goy03400]     GLS_c11960 DNA replication proteins [BR:goy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GLS_c11960 Chromosome and associated proteins [BR:goy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GLS_c11960 DNA repair and recombination proteins [BR:goy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GLS_c11960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AHK71100 UniProt:  A0A067Z630 LinkDB All DBs Position 1356130..1356399 Genome browser AA seq 89 aa AA seqDB search MSKAFLAAVLQDSMNCTGVVAQRAVNDMIDAIIEELREEGGFTLPSFGTFTVCETKARQA VNPRTGEPVEVSAGRTVRFKASPGLKQLV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaaagcttttcttgccgcagttctgcaggattccatgaactgcacaggggttgtt gcccagcgggcggtcaatgacatgattgacgccattattgaggagctgcgcgaagaaggt ggctttacgctgccatctttcgggacgttcacggtctgtgaaaccaaggcaaggcaggcc gtcaatccgcggaccggcgagcctgtcgaggtttcagcggggcggaccgtcaggttcaag gccagtccgggactgaagcagctcgtctga

DBGET integrated database retrieval system