Gluconobacter oxydans DSM 3504: GLS_c21530 Help Entry GLS_c21530        CDS       T03563                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism goy  Gluconobacter oxydans DSM 3504 Pathway goy01100   Metabolic pathways goy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:goy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GLS_c21530 (acpP)    00074 Mycolic acid biosynthesis     GLS_c21530 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GLS_c21530 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AHK72024 UniProt:  A0A067Z6Q8 LinkDB All DBs Position 2455528..2455767 Genome browser AA seq 79 aa AA seqDB search MSDIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKIATVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgctgacaaggtaaagaagatcgttgtcgagcacctcggtgtggacgaa agcaaggtaacgccggacgcgtcgttcatcgacgacctgggcgctgacagcctcgacacg gtcgagctggtcatggctttcgaagaagccttctccgtcgagatcccggaagatgcagcc gagaagatcgcaaccgtcaaggatgccatcgactacatcgagaagcagaaggcagcctga

DBGET integrated database retrieval system