Gluconobacter oxydans DSM 3504: GLS_c21690 Help Entry GLS_c21690        CDS       T03563                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism goy  Gluconobacter oxydans DSM 3504 Pathway goy01100   Metabolic pathways goy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:goy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GLS_c21690    00074 Mycolic acid biosynthesis     GLS_c21690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GLS_c21690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AHK72040 UniProt:  A0A067Z7X2 LinkDB All DBs Position complement(2470665..2470919) Genome browser AA seq 84 aa AA seqDB search MTDSVAGISGMIIEKLLANPKVPRDIDGNSKIVEDLAFDSLAVMNFVMEIEDELDVSVPL DKLADIRTINDLAGCLHTLKVAHA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactgacagcgtcgccggtatttccggaatgatcattgagaaactgcttgccaatccg aaagttccccgggacatcgatggcaacagcaagattgtcgaagacctggcctttgacagc ctggccgtcatgaacttcgtcatggaaatcgaagacgagctcgacgtctccgtcccactc gacaagctggccgatatccgcaccatcaacgaccttgccggctgcctgcacacgctgaag gtcgcccacgcgtga

DBGET integrated database retrieval system