Gamma proteobacterium HdN1: HDN1F_24850 Help Entry HDN1F_24850       CDS       T01300                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism gpb  Gamma proteobacterium HdN1 Pathway gpb01100   Metabolic pathways gpb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gpb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HDN1F_24850    00074 Mycolic acid biosynthesis     HDN1F_24850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HDN1F_24850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 ACP_SdgA_C MshEN MerR_2 Motif Other DBs NCBI-ProteinID:  CBL46068 LinkDB All DBs Position complement(3070043..3070309) Genome browser AA seq 88 aa AA seqDB search MSLETQAEIFEVLREIMCELFELEASRIQLNTRLYDDLEIDSIDAVDLMDRIRKLTGKKV SPEDFKSVVTLQDIVATIERLVQEKACA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcctcgaaacccaagcagaaatctttgaagttctgcgcgaaatcatgtgcgaacta tttgaactggaagcatctcgcatccagctcaacacccgcctttacgacgatctggaaatc gacagcattgatgccgtcgatcttatggatcgtatccgcaaactcaccggaaaaaaagtc agccccgaagacttcaaatccgttgttacgctccaagacatcgttgccacgattgagcgt ttagtgcaagagaaggcctgcgcatga

DBGET integrated database retrieval system