Gordonia pseudamarae: GII33_16535 Help Entry GII33_16535       CDS       T07482                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism gpd  Gordonia pseudamarae Brite KEGG Orthology (KO) [BR:gpd00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GII33_16535 Enzymes [BR:gpd01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GII33_16535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 GST_N_2 Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  QHN27316 LinkDB All DBs Position complement(3736958..3737236) Genome browser AA seq 92 aa AA seqDB search MSNVIDDDTRTSDDGELTMYTTSWCGYCARLKTALKASGIGWQEIDIEVNPDAAEFVGSV NGGNHVVPTVRYADGSTATNPSIAEVKAKLGV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagcaatgtgatcgatgacgacacgcgtacctccgacgacggcgaactgaccatgtac accacctcgtggtgtggttactgtgcacggctcaagaccgcgctcaaggccagcggtatc ggctggcaggagatcgacatcgaggtcaacccggatgcggccgagttcgtcggcagcgtc aacggcggcaaccatgtggtgcccaccgtgcggtacgccgacggcagcaccgccaccaat ccgtcgatcgccgaggtgaaggccaagctcggagtgtga

DBGET integrated database retrieval system