Geobacter pickeringii: GPICK_09175 Help Entry GPICK_09175       CDS       T03568                                  Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism gpi  Geobacter pickeringii Pathway gpi02024   Quorum sensing gpi03018   RNA degradation Brite KEGG Orthology (KO) [BR:gpi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GPICK_09175  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GPICK_09175  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gpi03019]     GPICK_09175    03036 Chromosome and associated proteins [BR:gpi03036]     GPICK_09175 Messenger RNA biogenesis [BR:gpi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GPICK_09175 Chromosome and associated proteins [BR:gpi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GPICK_09175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM DUF6982 Motif Other DBs NCBI-ProteinID:  AJE03497 UniProt:  A0A0B5BA82 LinkDB All DBs Position complement(2042172..2042396) Genome browser AA seq 74 aa AA seqDB search MAKAPFNIQDQYLNQSRKERVRVAVKLMSGEKLEGYIKSFDNFSVLMEIQGDILIYKHAI ASITSVDGSFRLHQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggctaaagcaccgttcaatatccaggaccagtacctgaaccagtcacgcaaggagcgg gtgagggtggccgtcaagttgatgtctggcgagaagctcgaagggtacataaaatccttc gacaatttttcggtgctgatggagatccagggcgacattttgatctacaagcacgcaatt gcgtcaatcacctcggttgacggcagtttcaggctccaccagtaa

DBGET integrated database retrieval system