Geomonas paludis: M1B72_03925 Help Entry M1B72_03925       CDS       T08160                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gpl  Geomonas paludis Pathway gpl01100   Metabolic pathways gpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gpl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M1B72_03925    00074 Mycolic acid biosynthesis     M1B72_03925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M1B72_03925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7300 Motif Other DBs NCBI-ProteinID:  UPU36867 LinkDB All DBs Position 935494..935727 Genome browser AA seq 77 aa AA seqDB search MELQERLNEVFCQVFDDEDIRIAPQMTADDIDGWDSLSHVNLIVAVETTFGIRFTHKEVL TFKNIGDLLNCIAAKVQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggaactgcaggagaggctgaacgaggttttttgccaggtatttgacgatgaagacatc cgcatcgccccccagatgaccgccgatgacatcgacggctgggattccctgtcccacgtg aatctcatcgtggcggtggaaaccaccttcggtatccgcttcacccacaaagaagtgctc accttcaagaacatcggcgacctgctgaactgcatcgcggcgaaagtgcagtaa

DBGET integrated database retrieval system