Geomonas paludis: M1B72_05080 Help Entry M1B72_05080       CDS       T08160                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gpl  Geomonas paludis Pathway gpl01100   Metabolic pathways gpl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gpl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M1B72_05080    00074 Mycolic acid biosynthesis     M1B72_05080   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M1B72_05080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UPU37084 LinkDB All DBs Position complement(1180588..1180830) Genome browser AA seq 80 aa AA seqDB search MDTMTSLNDIFREVFDDDTIEITRATTADDVDGWDSLSHTNLIVAVEMAYNVRFNLKDTR ALKDVGELIDLIDRKLAEKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataccatgacctctttgaacgacattttccgcgaggtcttcgatgacgacaccatc gagatcaccagggccactaccgccgacgacgtcgatggatgggactcgctctcccacacc aacctgatcgtagcggtggaaatggcgtacaacgtcaggttcaacctgaaggacaccagg gccctcaaggacgtaggcgaactgatcgacctgatcgacaggaaactggcggagaaaggc tag

DBGET integrated database retrieval system