Geomonas paludis: M1B72_06080 Help Entry M1B72_06080       CDS       T08160                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism gpl  Geomonas paludis Brite KEGG Orthology (KO) [BR:gpl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gpl03032]     M1B72_06080    03036 Chromosome and associated proteins [BR:gpl03036]     M1B72_06080    03400 DNA repair and recombination proteins [BR:gpl03400]     M1B72_06080 DNA replication proteins [BR:gpl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     M1B72_06080 Chromosome and associated proteins [BR:gpl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     M1B72_06080 DNA repair and recombination proteins [BR:gpl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       M1B72_06080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Urease_beta Motif Other DBs NCBI-ProteinID:  UPU37274 LinkDB All DBs Position 1421086..1421361 Genome browser AA seq 91 aa AA seqDB search MNKAELVSAIAEEAQLTKVDADKALTGILDALTNCLAAGDKVTLVGFGTFSVAERAARTG QNPQTGKKIEIAASTAPKFKPGNTLKELLNA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggcagaactggtaagcgccattgctgaagaagcacagttgaccaaggttgat gcagacaaggcactgactggaattcttgacgccctcaccaactgccttgccgcaggcgac aaggtaaccctggtcggcttcggcaccttcagcgtcgccgagcgcgccgcccgcaccggt cagaacccgcagaccggtaagaagatcgagatcgcggcttccaccgctccgaaattcaag ccgggcaacaccctgaaggaactgctcaacgcttaa

DBGET integrated database retrieval system