Gimesia panareensis: Pan110_20530
Help
Entry
Pan110_20530 CDS
T07079
Symbol
ftsI
Name
(GenBank) Peptidoglycan D,D-transpeptidase FtsI
KO
K03587
cell division protein FtsI (penicillin-binding protein 3) [EC:
3.4.16.4
]
Organism
gpn
Gimesia panareensis
Pathway
gpn00550
Peptidoglycan biosynthesis
gpn01100
Metabolic pathways
gpn01501
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:
gpn00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00550 Peptidoglycan biosynthesis
Pan110_20530 (ftsI)
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
Pan110_20530 (ftsI)
09180 Brite Hierarchies
09181 Protein families: metabolism
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
gpn01011
]
Pan110_20530 (ftsI)
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
gpn03036
]
Pan110_20530 (ftsI)
Enzymes [BR:
gpn01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.16 Serine-type carboxypeptidases
3.4.16.4 serine-type D-Ala-D-Ala carboxypeptidase
Pan110_20530 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:
gpn01011
]
Peptidoglycan biosynthesis and degradation
DD-Transpeptidase (Class B PBP)
Pan110_20530 (ftsI)
Chromosome and associated proteins [BR:
gpn03036
]
Prokaryotic type
Chromosome partitioning proteins
Divisome proteins
Pan110_20530 (ftsI)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Transpeptidase
PBP_dimer
PBP_dimer_2
Motif
Other DBs
NCBI-ProteinID:
QDU49714
LinkDB
All DBs
Position
2787921..2789705
Genome browser
AA seq
594 aa
AA seq
DB search
MKSGISQSRINWRSWILIGVVVMAWLVISGRLIYLQYVGHRQFKTVVTRQQVFKEKIPAR
PGDILDRNGRLLATTIVSNSLYVVPQRLKGTQQAIQVCAALQLDQRHFLKRLNENGDKLF
LWVKRRLTDAELAQIRALDLSDDAWGFRQEYRRQYPQGTLAAHALGLRDIDGKGQGGLEE
AFDHLICGQDGYRFLVRDAHGRVIEVRNDSRVAARNGETLVVTLDSIIQLYTERELQGIV
KDWKPKSACAIVMDVKTCEVLALASVPSFNLNHPEQIEERAWKNTAIASIYEPGSTLKPF
IVAAALEKGLVKRDDEFDCEHGEYRMGKRLLHDHHSYGMLSLTDILVKSSNIGMAKIGER
LTNAGLYEAVTAFGFGQKTGIQLPGELTGIVRPLKSWNIYSTGSVPMGQEIAVTPIQLIT
AHVALANQGKLLNPRLIRDQIDHNYFPRSEDEPAQVRPLVSTPLVSPEVADWLVRVPMVE
TVERGTGRRAKLDEYSVFGKTGTAQKPDPRTGQYSSQLHVSSFICGAPAHDPRVLVLVVV
NEPSVGENHYGGTIAGPPAAEILRKTLLYLRVPFDRSSQHFEDWSASRRRNILR
NT seq
1785 nt
NT seq
+upstream
nt +downstream
nt
ttgaaatccggcatatctcaatctcgaatcaactggcgaagctggatcctgatcggcgtg
gtggtgatggcctggctggttatctccggacgtttgatctatctgcagtacgtgggacac
cggcagtttaagaccgtggtgacgcggcaacaggtgttcaaagaaaaaatcccggcccgt
ccgggggacatcctggaccgcaatggacgtttactggctacgacgatcgtgtccaacagt
ctctacgtggtgccacagcggctgaaaggaactcaacaagcgatccaggtttgtgcagcg
ctgcaactggatcaacggcactttctgaaacgactcaacgaaaacggggacaagctgttt
ttgtgggtcaaacgacgtctgactgatgcggaactggcacagattcgcgctttggatctg
tcagatgatgcctggggctttcgccaggaatatcgcagacagtatccccagggaacgctg
gccgcccatgcgctgggcttacgcgatatcgacggtaaagggcagggagggctggaagaa
gccttcgatcatctgatctgcggtcaggatggatatcgttttctggtccgcgatgcgcat
ggccgtgtgattgaagtccgcaatgattcccgggtagcagcgcgcaacggtgagactctg
gtggtgacgctggattcgatcatccagctgtataccgagcgggaactgcagggcatcgtg
aaagactggaagccgaaaagtgcctgtgcgattgtgatggacgtcaaaacctgtgaagtg
ctggcgctggcatcggttccctcgtttaatttgaaccatccggagcaaattgaagaacgc
gcctggaaaaatacggccatcgcttcgatttacgagccggggtccacgttgaagcccttt
atcgtcgcagcggcactggagaaggggctggtcaaacgggatgacgaattcgattgtgag
catggtgagtaccgtatgggcaaacggctgctgcatgatcatcacagttacggcatgctg
agcctgacagatatcctggtgaaatcgagcaacatcgggatggcaaaaatcggagaacgc
ttgacgaatgcggggctttatgaagcagtcaccgcatttggtttcgggcagaagaccggc
attcaactgccaggggagctgaccggtattgttcgccctttgaagtcctggaatatttat
tcgaccggctcggtgcccatgggccaggaaatcgctgtaacacccattcagttgatcact
gcgcacgtcgcgctggccaatcagggaaagctgctgaatccccggctgattcgagaccag
atcgaccacaactacttcccgcgttctgaagatgaacccgctcaggttcgaccgctggtt
tctacgcctctggtttcacccgaggtggctgactggctggtgcgtgtgccgatggtcgag
acggtggagcgggggaccggacgcagagcgaagctcgacgaatattcggtcttcggcaag
acagggacggcgcagaaaccggatcctcgaacaggtcagtattcgtcccagttgcatgtc
agttcgttcatctgcggtgccccggcccatgatccgcgtgtcctggtgctggtggtggtg
aatgaaccatcggtcggggagaatcattacggggggacgatcgccggtccgcctgcagcg
gagattctgcgtaagaccctgctctatctcagggtgccctttgatcgttcgagtcagcac
tttgaggattggtctgccagccgcaggcgcaatattctgcgttga
DBGET
integrated database retrieval system