Gordonia polyisoprenivorans: GPOL_c33550 Help Entry GPOL_c33550       CDS       T01719                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism gpo  Gordonia polyisoprenivorans Brite KEGG Orthology (KO) [BR:gpo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     GPOL_c33550 Enzymes [BR:gpo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      GPOL_c33550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 Thioredoxin Motif Other DBs NCBI-ProteinID:  AFA74368 UniProt:  H6MZ32 LinkDB All DBs Position complement(3771870..3772142) Genome browser AA seq 90 aa AA seqDB search MGAMSEATATPTDQLTMYTTSWCGFCARLKTGLRSAGIEWNEIDIEAHPEAAEFVGSVNG GNHVVPTVLYADGSTATNPSIAEVRAKLGV NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgggtgccatgagtgaggcaaccgcaaccccgaccgatcagctgaccatgtacaccacc agctggtgcggcttctgcgcacgactcaagaccggattgcgcagcgccgggatcgagtgg aacgagatcgacatcgaggcccaccccgaggccgccgagttcgtcggcagtgtcaacggc ggtaatcacgtcgtccccaccgtgctctacgccgacgggtcgaccgccaccaaccccagc attgccgaggtgcgggccaaactgggcgtctga

DBGET integrated database retrieval system