Glutamicibacter protophormiae: JQN66_07840 Help Entry JQN66_07840       CDS       T07442                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gpr  Glutamicibacter protophormiae Pathway gpr01100   Metabolic pathways gpr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gpr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JQN66_07840    00074 Mycolic acid biosynthesis     JQN66_07840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JQN66_07840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Pro_sub2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QRQ80091 LinkDB All DBs Position complement(1690365..1690610) Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNSETGLDEADVQLDKSFTEDLDIDSISMMTIVVEAEEKFEVKIPD EEVKNLKTVGDAVSFIAGAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggcaggcctcgccgaaatcgttaactcggagaccggc ctggacgaagcagacgtgcagctggacaagtccttcaccgaggacctggacatcgactcg atctcgatgatgaccatcgtcgttgaggccgaggaaaagttcgaggtcaagatcccggac gaggaagtcaagaacctgaagaccgtgggcgacgccgtgagcttcatcgccggcgcccag gcctag

DBGET integrated database retrieval system