Glutamicibacter protophormiae: JQN66_13195 Help Entry JQN66_13195       CDS       T07442                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism gpr  Glutamicibacter protophormiae Brite KEGG Orthology (KO) [BR:gpr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gpr03032]     JQN66_13195    03036 Chromosome and associated proteins [BR:gpr03036]     JQN66_13195    03400 DNA repair and recombination proteins [BR:gpr03400]     JQN66_13195 DNA replication proteins [BR:gpr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     JQN66_13195 Chromosome and associated proteins [BR:gpr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     JQN66_13195 DNA repair and recombination proteins [BR:gpr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       JQN66_13195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QRQ77865 LinkDB All DBs Position complement(2817176..2817454) Genome browser AA seq 92 aa AA seqDB search MNRSELVAAVAAKTENSQVAVNGVLDAVFDVFVEQISQGEKVSIPGWLAVERTDRAARTG RNPQTGEAIEIPAGHSVKLTAGSKLKAAVAKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaccgtagcgaacttgttgccgctgttgcagcgaagaccgaaaactcccaggttgcc gtcaacggtgttctggatgctgttttcgacgttttcgttgagcagatctcgcagggcgag aaggtttcgatcccaggttggctggcagtggagcgcaccgaccgtgccgctcgcaccggc cgcaacccgcagaccggcgaagccatcgagattcctgctggccactcggtgaagctgacc gctggttcgaagctgaaggccgctgtcgccaagaagtaa

DBGET integrated database retrieval system