Paraglaciecola psychrophila: C427_2807 Help Entry C427_2807         CDS       T02535                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gps  Paraglaciecola psychrophila Pathway gps01100   Metabolic pathways gps01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gps00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C427_2807 (acpP)    00074 Mycolic acid biosynthesis     C427_2807 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C427_2807 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AGH44916 UniProt:  K7ALF7 LinkDB All DBs Position 2653349..2653588 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVIEQLGVKEEEVKPEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQSAIDYVNANKDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtactatcgaagaacgtgtaaaaaaaatcgtcattgagcaacttggtgttaaagaa gaggaagttaaaccagaagcttcattcgttgatgatttaggtgcggattcactagacact gtcgaattagtaatggcccttgaagaagagttcgatactgaaattcctgatgaagaagct gaaaaaattaccactgttcagtctgctattgactacgttaacgctaataaagacgcataa

DBGET integrated database retrieval system