Gibbsiella quercinecans: AWC35_03090 Help Entry AWC35_03090       CDS       T05060                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gqu  Gibbsiella quercinecans Pathway gqu01100   Metabolic pathways gqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWC35_03090    00074 Mycolic acid biosynthesis     AWC35_03090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWC35_03090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding MerR_2 NapD DUF3913 DIMCO_N Motif Other DBs NCBI-ProteinID:  ATA18415 UniProt:  A0A250AX37 LinkDB All DBs Position complement(689791..690042) Genome browser AA seq 83 aa AA seqDB search MMDKNEIYQEISGLLVKLFEVDVNDIKPEARLYEDLELDSIDAVDMVVHLQKRIGRKISP ETFKTVRTVQDVVNAVEQLLQAD NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgatggataagaacgaaatttatcaggaaatctccgggctgctggtcaaactgtttgaa gtcgatgtgaatgatatcaagccggaagcgcggctgtatgaagatctggagctcgacagt attgacgctgtggacatggtcgtgcatctgcaaaagcgtattggccgcaaaatttcaccg gaaacgtttaagacggtgcgtacggtacaggatgtggtgaatgccgttgagcagttgctg caggcggattaa

DBGET integrated database retrieval system