Gibbsiella quercinecans: AWC35_03095 Help Entry AWC35_03095       CDS       T05060                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gqu  Gibbsiella quercinecans Pathway gqu01100   Metabolic pathways gqu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gqu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWC35_03095    00074 Mycolic acid biosynthesis     AWC35_03095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWC35_03095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATA18416 UniProt:  A0A250AX69 LinkDB All DBs Position complement(690068..690325) Genome browser AA seq 85 aa AA seqDB search MDELSLEIKQMIIDALNLEEVCVDDIDTNAPLFGDGLGLDSIDALELGLAVKNRYGVMLS AESNEMRQHFFSVATLTAFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggacgaattatcccttgaaataaagcaaatgattatcgacgccttgaacctggaagag gtctgcgtagacgacattgacaccaacgcccctttgtttggcgatgggttgggtctggat tctattgatgccctggaactggggctggcggtgaaaaatcgctatggcgtgatgctctcg gcagagagtaatgaaatgcgtcagcattttttctcggtggctacgctcaccgccttcatc aacgctcagcgcgcgtga

DBGET integrated database retrieval system