Gibbsiella quercinecans: AWC35_06370 Help Entry AWC35_06370       CDS       T05060                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism gqu  Gibbsiella quercinecans Brite KEGG Orthology (KO) [BR:gqu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gqu03032]     AWC35_06370    03036 Chromosome and associated proteins [BR:gqu03036]     AWC35_06370    03400 DNA repair and recombination proteins [BR:gqu03400]     AWC35_06370 DNA replication proteins [BR:gqu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AWC35_06370 Chromosome and associated proteins [BR:gqu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AWC35_06370 DNA repair and recombination proteins [BR:gqu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AWC35_06370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 UFL1_C Motif Other DBs NCBI-ProteinID:  ATA18995 UniProt:  A0A250AYT4 LinkDB All DBs Position complement(1411957..1412229) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAADADISKAAAGRALDAIIASVTESLKEGDDVALVGFGSFTVRERSARTG RNPQTGKEIKIAAAKVPAFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtcacaactgatcgacaaaattgccgcagatgctgatatttcgaaagcggca gctgggcgtgctttagatgcaatcattgcatccgttacggaatccttgaaggaaggggat gacgtggctctggtaggtttcggttcatttaccgtgcgtgagcgttcagcccgcactggc cgcaacccacaaaccggtaaagagatcaaaattgctgcggccaaagttccggctttccgc gcaggtaaagcgttgaaagacgccgtaaactga

DBGET integrated database retrieval system