Gossypium raimondii: 105762943 Help Entry 105762943         CDS       T04129                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism gra  Gossypium raimondii Pathway gra03083   Polycomb repressive complex gra04120   Ubiquitin mediated proteolysis gra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105762943    04120 Ubiquitin mediated proteolysis     105762943   09126 Chromosome    03083 Polycomb repressive complex     105762943  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gra04131]     105762943    04121 Ubiquitin system [BR:gra04121]     105762943    03036 Chromosome and associated proteins [BR:gra03036]     105762943 Membrane trafficking [BR:gra04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105762943 Ubiquitin system [BR:gra04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      105762943    Cul7 complex      105762943 Chromosome and associated proteins [BR:gra03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105762943   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105762943 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Methyltransf_16 Motif Other DBs NCBI-GeneID:  105762943 NCBI-ProteinID:  XP_012436384 UniProt:  A0A0D2PNC8 LinkDB All DBs Position 12:4593537..4594217 Genome browser AA seq 141 aa AA seqDB search MGSTSKKIKLRTSDGEILKVEEAVALQSPTIKNLYENSCPGRVIPVPGVTGNILSKVLDY GKKHVDAATGKENISADELKAWDDDFVKVDQKTLFDLILAARSLNIECLLDLTCRTVANM IKGKTVEEIRTTFNIKNDLDP NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgggatcaacatcgaagaagataaagttgaggacctccgacggggagattttaaaggtg gaggaagcggttgcactccagtctccgacgattaaaaacttgtacgaaaatagttgcccc ggcagagtcatccctgtccctggcgtcaccggaaacatcttatccaaggttctcgactac ggcaagaagcacgtagatgccgccactggtaaggaaaacatctccgctgacgaactcaag gcatgggatgatgattttgtcaaggttgatcaaaaaaccctcttcgacctcattctggcg gcccgctctttgaatatagagtgcttgttggacttgacatgccgaactgttgccaacatg ataaaggggaagacagtcgaggagattcgcactaccttcaacatcaagaacgatttagac ccctga

DBGET integrated database retrieval system