Gossypium raimondii: 105770909 Help Entry 105770909         CDS       T04129                                  Name (RefSeq) DNA polymerase II subunit B4   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism gra  Gossypium raimondii Pathway gra03030   DNA replication gra03082   ATP-dependent chromatin remodeling gra03410   Base excision repair gra03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gra00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105770909    03410 Base excision repair     105770909    03420 Nucleotide excision repair     105770909   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105770909  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gra03032]     105770909    03036 Chromosome and associated proteins [BR:gra03036]     105770909    03400 DNA repair and recombination proteins [BR:gra03400]     105770909 Enzymes [BR:gra01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      105770909 DNA replication proteins [BR:gra03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     105770909 Chromosome and associated proteins [BR:gra03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     105770909 DNA repair and recombination proteins [BR:gra03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       105770909 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone Bromo_TP DUF5427 TAF VIR_N RNA_pol_3_Rpc31 DUF4746 NOA36 Motif Other DBs NCBI-GeneID:  105770909 NCBI-ProteinID:  XP_012447729 UniProt:  A0A0D2TG48 LinkDB All DBs Position 5:complement(6248661..6249640) Genome browser AA seq 167 aa AA seqDB search MEKVVSEAEELPKAIVRRVVKEKLSECSPDYDFNVHKDAHLAFTESARIFIHYLSATAND ICKESKRQTMNAEDVFKALEEIEFSEFVKPLRASLAEFRKKNAGKKGGAAKENEVKKKRK IEYSSAKNGTKTKQKKEDNHKEEEQVEGEQEQDEEEDNEEEENHGSE NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggagaaagtggtatcggaggcggaagagctgccgaaggcgatcgtgcgacgggtggtg aaggagaagctctctgagtgttcaccagattacgactttaacgttcacaaagacgcccac ctcgctttcaccgaaagcgctcgcatcttcatccattacctttccgctacggcaaatgac atatgcaaggaatcgaagaggcaaacaatgaatgcggaggatgtgtttaaagcacttgaa gaaattgaattctcggaatttgttaaacctctgagggcttcgcttgctgagttcaggaag aagaatgctgggaaaaagggtggagcagccaaggaaaatgaggtcaaaaagaagaggaaa atagagtattcatctgccaaaaatggaacaaaaaccaagcaaaagaaagaggataatcat aaagaagaagaacaagtcgaaggagaacaagagcaagacgaagaagaagataatgaagaa gaggaaaatcatggaagtgagtga

DBGET integrated database retrieval system