Gossypium raimondii: 105772613 Help Entry 105772613         CDS       T04129                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism gra  Gossypium raimondii Pathway gra04145   Phagosome gra04148   Efferocytosis gra04517   IgSF CAM signaling gra04518   Integrin signaling gra04620   Toll-like receptor signaling pathway gra05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:gra00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105772613    04518 Integrin signaling     105772613  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105772613    04148 Efferocytosis     105772613  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105772613  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105772613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gra04131]     105772613   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gra04147]     105772613    04031 GTP-binding proteins [BR:gra04031]     105772613 Membrane trafficking [BR:gra04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105772613  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105772613   Macropinocytosis    Ras GTPases     105772613  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105772613 Exosome [BR:gra04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105772613   Exosomal proteins of other body fluids (saliva and urine)    105772613   Exosomal proteins of colorectal cancer cells    105772613   Exosomal proteins of bladder cancer cells    105772613 GTP-binding proteins [BR:gra04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105772613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf B12-binding Motif Other DBs NCBI-GeneID:  105772613 NCBI-ProteinID:  XP_012449445 UniProt:  A0A0D2V3G3 LinkDB All DBs Position 6:complement(104712..106752) Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVTKKWIPELKHYAPGVPIVLVGTKL DLRDDQQFFVDHPGAVLISTAQGEELRKQVGSSAYIECSSKTQQNVKAVFDSAIKVVLQP PKKSKKKKAHGGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctccagattcataaagtgtgttactgtcggcgatggtgctgtcggcaaaact tgcttgcttatttcctacaccagcaacactttccctacggattatgtccctactgttttc gacaatttcagtgcaaatgttgttgtggatggcagcactgtcaacttaggtttatgggat actgctggtcaagaggattacaatagattgagaccattaagctatcgtggggccgatgtc tttattcttgcattttccctcatcagcaaggctagttacgaaaatgttacaaagaagtgg attcctgaattaaagcattatgcacctggtgttccgatagttcttgttggaactaagctt gatctccgggatgatcagcaattctttgtagaccatcctggtgcagtgctcatttctaca gctcagggtgaagaattaaggaaacaggtagggtcttctgcctacatcgagtgtagttca aaaacacagcagaatgtgaaggcagtttttgattcagctattaaggtagtgcttcagcct ccgaagaaaagcaagaagaaaaaggcacatggtggttgctcaatattgtga

DBGET integrated database retrieval system