Gossypium raimondii: 105775619 Help Entry 105775619         CDS       T04129                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism gra  Gossypium raimondii Pathway gra03083   Polycomb repressive complex gra04120   Ubiquitin mediated proteolysis gra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105775619    04120 Ubiquitin mediated proteolysis     105775619   09126 Chromosome    03083 Polycomb repressive complex     105775619  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gra04131]     105775619    04121 Ubiquitin system [BR:gra04121]     105775619    03036 Chromosome and associated proteins [BR:gra03036]     105775619 Membrane trafficking [BR:gra04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     105775619 Ubiquitin system [BR:gra04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      105775619    Cul7 complex      105775619 Chromosome and associated proteins [BR:gra03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      105775619   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      105775619 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ SNARE DUF7900 Motif Other DBs NCBI-GeneID:  105775619 NCBI-ProteinID:  XP_012453573 LinkDB All DBs Position 10:complement(55418840..55419407) Genome browser AA seq 148 aa AA seqDB search MLSSKNSALESKDNEIFEVEESIAIQSELIKTMATMVNSKAYVNERNQMGCWKQANYHVE QNNKIVDEELSDWESKFFEVDMDDLHELFMAANYLEIESLLNGVAKRVADIIKACMNVEV IRQTFGINNDFAAQQEEEIRKLNSWNHI NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgttgtcgtccaagaattctgcattggagagcaaagacaatgaaatctttgaggtcgaa gaatccattgccattcaatctgagctcatcaaaaccatggcgaccatggtgaacagcaag gcctacgttaacgaacgtaatcaaatgggatgctggaaacaagccaattatcacgtcgag caaaacaacaaaattgttgatgaagaactaagcgattgggaatcaaaattctttgaggtt gatatggatgatcttcacgagcttttcatggcagccaattacctggaaattgaaagcttg ttgaatggagtggcgaaacgagttgcggacattatcaaagcttgcatgaatgttgaggta attcgtcagacttttggaattaacaacgattttgctgctcaacaagaagaggaaattcgt aagcttaattcttggaaccatatttga

DBGET integrated database retrieval system