Gossypium raimondii: 105780716 Help Entry 105780716         CDS       T04129                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism gra  Gossypium raimondii Pathway gra04136   Autophagy - other Brite KEGG Orthology (KO) [BR:gra00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     105780716  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gra04131]     105780716    04121 Ubiquitin system [BR:gra04121]     105780716    03029 Mitochondrial biogenesis [BR:gra03029]     105780716 Membrane trafficking [BR:gra04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     105780716 Ubiquitin system [BR:gra04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105780716 Mitochondrial biogenesis [BR:gra03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     105780716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  105780716 NCBI-ProteinID:  XP_012460651 UniProt:  A0A0D2TGI4 LinkDB All DBs Position 4:complement(49365105..49367733) Genome browser AA seq 94 aa AA seqDB search MAAESPSSARKVVVHLRATGDAPILKQAKFKILGTDKFAKVIDFLRRQLHRDTLFVYVNS AFSPNPDELVIDLYDNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcagctgagtctcccagttcagcacgaaaagttgttgtccatttgagagcaactggg gatgcccccatactaaaacaagccaaattcaagatacttggaactgacaaatttgctaaa gtaattgattttttgcgtcggcaattgcaccgtgatacactgtttgtgtatgtaaacagt gccttctcaccaaacccagatgaattggtgattgatctgtatgataattttggttttgat ggcaaactggtggttaattatgcctgttctatggcatggggctaa

DBGET integrated database retrieval system