Granulicella sp. 5B5: GOB94_08835 Help Entry GOB94_08835       CDS       T08433                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism grb  Granulicella sp. 5B5 Brite KEGG Orthology (KO) [BR:grb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:grb03032]     GOB94_08835    03036 Chromosome and associated proteins [BR:grb03036]     GOB94_08835    03400 DNA repair and recombination proteins [BR:grb03400]     GOB94_08835 DNA replication proteins [BR:grb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GOB94_08835 Chromosome and associated proteins [BR:grb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GOB94_08835 DNA repair and recombination proteins [BR:grb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GOB94_08835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QMV18776 UniProt:  A0A7D7X971 LinkDB All DBs Position complement(2121447..2121743) Genome browser AA seq 98 aa AA seqDB search MAKGMTKTALVRHLAEKLELTNKQTAGFLELLAETAVKETKKNGEFTIPGIGKLVKAERK ARIGRNPQTGEAIKIKAKTVVKFRVAKVAKDTIAPPKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggctaagggaatgacaaagacagcactggtccgccacctggcggagaagctcgaactg acgaacaagcagaccgctggctttctggagctgctggctgagacggcagtgaaggagacc aagaagaacggcgagttcacgatccccggcatcggcaagctggtgaaggcagagcgcaag gcgcgcatcggccgcaacccgcagacgggtgaggcgatcaagatcaaggcgaagaccgtg gtgaagttccgcgtggcgaaggtcgcgaaggacacgatcgctccgccgaagaagtaa

DBGET integrated database retrieval system