KEGG   Gracilibacillus salitolerans: GI584_12825
Entry
GI584_12825       CDS       T06279                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
grc  Gracilibacillus salitolerans
Brite
KEGG Orthology (KO) [BR:grc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:grc03000]
    GI584_12825
Transcription factors [BR:grc03000]
 Prokaryotic type
  Other transcription factors
   Others
    GI584_12825
SSDB
Motif
Pfam: Bmp YoqO CoA_binding_2
Other DBs
NCBI-ProteinID: QGH34865
UniProt: A0A5Q2TJL0
LinkDB
Position
complement(2713670..2714653)
AA seq 327 aa
MEAKRQVKYIIGITLIVVSIFVIFLVFKSNQIMDNMNASETSSTKVLILTTDRLNDQSWG
SLAYKGKILIEEEYNVTAEVLGEVDAEKDTSSLVEEYVDQDYELIIGHGREFSEPFYRII
NQYKDVQFVTIHGDNIANNLAVYTFNQNEVEVIAGMAAGLKTKSKKIGLIDAVDNKHKDW
GFPQGIELIDDKIELIYKVVPERTNKSDAKLFAANLIEEGVDVIYTKGNSYNQEVINYAK
EHGIYIIGYLEDQSYMAEDKVLTSVLNNVPMAYSAILRDFLSEEGIKFEKKYLDVDDGVY
GIAPFGSMFSEDEIQTIEEVTDHEIPR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggaggcaaaaagacaggtgaaatacataataggaattactttgattgtggtatcgatc
tttgttatttttttagtgttcaaatctaatcagataatggataatatgaatgcttctgaa
acatcttctactaaagtattaatcttaacgactgatcgattaaatgatcaaagctgggga
agcttggcttataaaggcaaaattctcattgaagaagagtataatgtaactgccgaagtt
cttggagaagtggatgcagaaaaggatacgtcttcacttgtagaagaatatgttgaccaa
gactatgaattgattatcggacatggtagagaattttcagagccattttatcgaatcatc
aatcaatataaggatgttcagtttgtgaccattcatggtgataatatcgcgaataaccta
gctgtgtatactttcaatcaaaatgaagtagaagttattgcaggtatggctgctggatta
aaaactaagtcgaaaaaaattggtctaatagatgctgttgataataaacataaggattgg
ggatttcctcaaggtattgaattaattgatgataaaatagaattgatctataaagtagta
ccggaaagaacaaataaatctgacgccaaattatttgctgctaatttgatcgaagagggt
gtagatgtcatctatacgaaaggaaacagctacaatcaagaagttattaattatgccaaa
gaacatggtatctatattatagggtacttggaagatcaatcttatatggctgaagataaa
gtgcttactagtgttttaaataatgtgccaatggcctattctgctattttgagagatttt
ctaagtgaagaaggaattaagtttgaaaagaaatacttggatgttgatgatggggtttat
ggtatagcaccatttggttctatgttttcggaagatgaaattcaaacaatcgaagaagta
acagatcatgaaataccgcgctaa

DBGET integrated database retrieval system