Garra rufa (doctor fish): 141286599 Help Entry 141286599         CDS       T11039                                  Symbol nras Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism grf  Garra rufa (doctor fish) Pathway grf04010   MAPK signaling pathway grf04012   ErbB signaling pathway grf04068   FoxO signaling pathway grf04137   Mitophagy - animal grf04140   Autophagy - animal grf04150   mTOR signaling pathway grf04210   Apoptosis grf04218   Cellular senescence grf04370   VEGF signaling pathway grf04371   Apelin signaling pathway grf04540   Gap junction grf04625   C-type lectin receptor signaling pathway grf04810   Regulation of actin cytoskeleton grf04910   Insulin signaling pathway grf04912   GnRH signaling pathway grf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:grf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141286599 (nras)    04012 ErbB signaling pathway     141286599 (nras)    04370 VEGF signaling pathway     141286599 (nras)    04371 Apelin signaling pathway     141286599 (nras)    04068 FoxO signaling pathway     141286599 (nras)    04150 mTOR signaling pathway     141286599 (nras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141286599 (nras)    04137 Mitophagy - animal     141286599 (nras)   09143 Cell growth and death    04210 Apoptosis     141286599 (nras)    04218 Cellular senescence     141286599 (nras)   09144 Cellular community - eukaryotes    04540 Gap junction     141286599 (nras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     141286599 (nras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     141286599 (nras)   09152 Endocrine system    04910 Insulin signaling pathway     141286599 (nras)    04912 GnRH signaling pathway     141286599 (nras)    04916 Melanogenesis     141286599 (nras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:grf04131]     141286599 (nras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141286599 (nras)    04031 GTP-binding proteins [BR:grf04031]     141286599 (nras) Membrane trafficking [BR:grf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     141286599 (nras)  Endocytosis   Macropinocytosis    Ras GTPases     141286599 (nras) Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141286599 (nras)   Exosomal proteins of other body fluids (saliva and urine)    141286599 (nras)   Exosomal proteins of breast cancer cells    141286599 (nras)   Exosomal proteins of colorectal cancer cells    141286599 (nras) GTP-binding proteins [BR:grf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     141286599 (nras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  141286599 NCBI-ProteinID:  XP_073674747 LinkDB All DBs Position 15:34996072..35006091 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcagaatcactttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggt caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggttttctctgt gtcttcgccataaacaacagcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgtgtgaaggactcagatgatgttccgatggtcctggtggggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt gtagaaacttctgccaagaccagacagggagtcgaggatgctttttacaccctcgtccgt gagatccgacattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system