Garra rufa (doctor fish): 141286653 Help Entry 141286653         CDS       T11039                                  Symbol rab7b Name (RefSeq) ras-related protein Rab-7b   KO K07897   Ras-related protein Rab-7A Organism grf  Garra rufa (doctor fish) Pathway grf04137   Mitophagy - animal grf04140   Autophagy - animal grf04144   Endocytosis grf04145   Phagosome grf04148   Efferocytosis grf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:grf00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141286653 (rab7b)    04145 Phagosome     141286653 (rab7b)    04140 Autophagy - animal     141286653 (rab7b)    04137 Mitophagy - animal     141286653 (rab7b)    04148 Efferocytosis     141286653 (rab7b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141286653 (rab7b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:grf04131]     141286653 (rab7b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141286653 (rab7b)    04031 GTP-binding proteins [BR:grf04031]     141286653 (rab7b) Membrane trafficking [BR:grf04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     141286653 (rab7b) Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141286653 (rab7b)   Exosomal proteins of other body fluids (saliva and urine)    141286653 (rab7b)   Exosomal proteins of colorectal cancer cells    141286653 (rab7b)   Exosomal proteins of bladder cancer cells    141286653 (rab7b) GTP-binding proteins [BR:grf04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     141286653 (rab7b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 PduV-EutP Septin nSTAND3 AAA_7 AAA_16 NTPase_1 AAA_22 AAA_24 G-alpha ATPase_2 SRPRB AAA_5 ABC_tran ATP-synt_ab AAA_14 NACHT MCM Motif Other DBs NCBI-GeneID:  141286653 NCBI-ProteinID:  XP_073674817 LinkDB All DBs Position 15:complement(5033222..5057059) Genome browser AA seq 204 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQETVE TYDFPDQIKLRDDRPVSSSDGCSC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaagaaggtgctgctcaaagtgatcatcctaggggattctggagttggg aagacctctctgatgaaccagtatgtgaataacaagttcagtaaccagtataaggccaca atcggagctgacttcctgactaaggaagtgatggtggacgacagactggtcaccatgcag atttgggacacggccggtcaagagcgctttcagtctctgggcgtggcgttttacagaggg gctgactgttgtgtgctggtgtacgacgttacagcacccactacatttaagactctggac agctggagggatgagtttctcattcaggccagtccacgcgacccggagaacttccccttt gttgtgctgggcaacaaaatcgacctggagaaccggcaggtaacgacaaagcgagctcaa gcgtggtgtcagagtaagaacaacatcccctattttgagaccagtgccaaagaagccatt aacgtggaccaggccttccaaaccatcgctcgcaatgcacttaaacaggagacagtggag acgtacgatttccccgaccagattaaactaagagacgacagacctgtgtctagcagtgat ggctgcagctgctga

DBGET integrated database retrieval system