Garra rufa (doctor fish): 141301079 Help Entry 141301079         CDS       T11039                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism grf  Garra rufa (doctor fish) Pathway grf04010   MAPK signaling pathway grf04012   ErbB signaling pathway grf04068   FoxO signaling pathway grf04137   Mitophagy - animal grf04140   Autophagy - animal grf04144   Endocytosis grf04150   mTOR signaling pathway grf04210   Apoptosis grf04218   Cellular senescence grf04370   VEGF signaling pathway grf04371   Apelin signaling pathway grf04510   Focal adhesion grf04540   Gap junction grf04625   C-type lectin receptor signaling pathway grf04810   Regulation of actin cytoskeleton grf04910   Insulin signaling pathway grf04912   GnRH signaling pathway grf04916   Melanogenesis grf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:grf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141301079    04012 ErbB signaling pathway     141301079    04370 VEGF signaling pathway     141301079    04371 Apelin signaling pathway     141301079    04068 FoxO signaling pathway     141301079    04150 mTOR signaling pathway     141301079  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141301079    04140 Autophagy - animal     141301079    04137 Mitophagy - animal     141301079   09143 Cell growth and death    04210 Apoptosis     141301079    04218 Cellular senescence     141301079   09144 Cellular community - eukaryotes    04510 Focal adhesion     141301079    04540 Gap junction     141301079   09142 Cell motility    04810 Regulation of actin cytoskeleton     141301079  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     141301079   09152 Endocrine system    04910 Insulin signaling pathway     141301079    04912 GnRH signaling pathway     141301079    04916 Melanogenesis     141301079  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141301079  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:grf04131]     141301079   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141301079    04031 GTP-binding proteins [BR:grf04031]     141301079 Membrane trafficking [BR:grf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     141301079  Endocytosis   Macropinocytosis    Ras GTPases     141301079 Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    141301079   Exosomal proteins of colorectal cancer cells    141301079 GTP-binding proteins [BR:grf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     141301079 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  141301079 NCBI-ProteinID:  XP_073687434 LinkDB All DBs Position 25:29435228..29479541 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggggagacatgtctcttggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgcggacgggcgagggcttcctctgt gtgttcgccatcaataacaccaagtcctttgaggacattcatcaatacagggaacagatc aaacgggtaaaggactcggatgacgtgcccatggtgctggtgggcaacaaatgcgacctc ccggcccggacggtggacacgcggcaagcgcaggagctcgcccgcagttacgggatcccc ttcatcgagacctcagccaaaacacgacagggtgtggaggacgcgttttacacgctggtg cgggagatccgtcagcacaagatgaggaagctgaacccaccggacgagagcggacaggac tgcatgagctgccgctgcgtcgtgtcgtga

DBGET integrated database retrieval system