Garra rufa (doctor fish): 141325586 Help Entry 141325586         CDS       T11039                                  Symbol cenpx Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism grf  Garra rufa (doctor fish) Pathway grf03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:grf00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     141325586 (cenpx)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:grf03400]     141325586 (cenpx) DNA repair and recombination proteins [BR:grf03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      141325586 (cenpx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF TAFII28 PPV_E1_DBD COMMD9_HN HyaE Histone Motif Other DBs NCBI-GeneID:  141325586 NCBI-ProteinID:  XP_073690468 LinkDB All DBs Position 1:60126244..60132522 Genome browser AA seq 81 aa AA seqDB search MANAGNEVVFKKETVSKLLTRSFKEDKTKVSSDAVVLVAEMLKVFVEEATRRAVKQADSE DCDTVDIEHFEKILPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcgaacgcgggaaatgaagtcgtgtttaaaaaggaaactgtttccaaacttttgaca cgctcttttaaggaggataaaaccaaagtcagcagtgatgctgtcgtacttgtagcagag atgctgaaagtatttgttgaagaggcgacgcgcagagctgttaaacaggccgacagtgag gactgcgacactgttgacattgagcactttgaaaagattctgccacaattgcttcttgac ttttaa

DBGET integrated database retrieval system