Garra rufa (doctor fish): 141331776 Help Entry 141331776         CDS       T11039                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism grf  Garra rufa (doctor fish) Pathway grf03082   ATP-dependent chromatin remodeling grf04217   Necroptosis Brite KEGG Orthology (KO) [BR:grf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     141331776  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     141331776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:grf03036]     141331776   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141331776 Chromosome and associated proteins [BR:grf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     141331776 Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141331776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  141331776 NCBI-ProteinID:  XP_073692906 LinkDB All DBs Position 3:complement(1424510..1424896) Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKSAKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggcagaggcaaaaccggcggaaaagtgagagccaaggctaagacacgctcatcc agggcagggctgcagttccccgtcggtcgtgttcacaggcttctccgtaaagggaactac gccgagcgcgttggtgccggtgctcccgtctatctggcggctgtgctcgagtatcttacc gctgagatcctggagttggctggaaacgccgcgagggacaacaagaaaacccgtatcatt ccccgtcacctgcagctggcggtgcgcaatgacgaggagctcaacaaacttctgggcgga gtgaccatcgctcagggcggcgtgctgcccaacatccaggctgtgcttctgcccaaaaag accgaaaaatctgccaaaaccaaataa

DBGET integrated database retrieval system