Garra rufa (doctor fish): 141335520 Help Entry 141335520         CDS       T11039                                  Name (RefSeq) insulin   KO K04526   insulin Organism grf  Garra rufa (doctor fish) Pathway grf04010   MAPK signaling pathway grf04068   FoxO signaling pathway grf04081   Hormone signaling grf04114   Oocyte meiosis grf04140   Autophagy - animal grf04150   mTOR signaling pathway grf04810   Regulation of actin cytoskeleton grf04910   Insulin signaling pathway grf04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:grf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141335520    04068 FoxO signaling pathway     141335520    04150 mTOR signaling pathway     141335520   09133 Signaling molecules and interaction    04081 Hormone signaling     141335520  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     141335520   09143 Cell growth and death    04114 Oocyte meiosis     141335520   09142 Cell motility    04810 Regulation of actin cytoskeleton     141335520  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     141335520    04914 Progesterone-mediated oocyte maturation     141335520  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:grf04052]     141335520 Cytokines and neuropeptides [BR:grf04052]  Neuropeptides   Unclassified    141335520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  141335520 NCBI-ProteinID:  XP_073697114 LinkDB All DBs Position 5:complement(27640197..27641466) Genome browser AA seq 108 aa AA seqDB search MAVWLQAGALLFLLAVSSVNANAGAPQHLCGSHLVDALYLVCGPTGFFYNPKRDVDPLMG FLPPKSAQETEVADFAFKDHAEVIRKRGIVEQCCHKPCSIFELQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagtgtggctccaggctggtgctctgttgttcctgttggccgtctccagtgtgaac gcaaacgcaggggccccacagcacctgtgtggatctcacctggtcgatgccctctatctg gtctgtggtccaacaggattcttctacaaccccaagagagatgttgaccctcttatgggt ttccttcctccaaaatctgcccaagaaactgaggtggctgactttgcatttaaagatcat gccgaggtgataaggaagagaggcattgtggagcagtgttgccacaaaccctgcagtatc tttgagctgcagaactactgtaactaa

DBGET integrated database retrieval system