Garra rufa (doctor fish): 141337499 Help Entry 141337499         CDS       T11039                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism grf  Garra rufa (doctor fish) Pathway grf03030   DNA replication grf03410   Base excision repair grf03420   Nucleotide excision repair grf03430   Mismatch repair grf03440   Homologous recombination Brite KEGG Orthology (KO) [BR:grf00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     141337499 (pold4)    03410 Base excision repair     141337499 (pold4)    03420 Nucleotide excision repair     141337499 (pold4)    03430 Mismatch repair     141337499 (pold4)    03440 Homologous recombination     141337499 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:grf03032]     141337499 (pold4)    03400 DNA repair and recombination proteins [BR:grf03400]     141337499 (pold4) DNA replication proteins [BR:grf03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     141337499 (pold4) DNA repair and recombination proteins [BR:grf03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       141337499 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      141337499 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  141337499 NCBI-ProteinID:  XP_073699440 LinkDB All DBs Position 6:complement(18086997..18090698) Genome browser AA seq 108 aa AA seqDB search MTPKRGLITDTFKVVKKARRGGKRDKSPSPPVAEPEPPQLSEREKDLLELKKFDLDWKFG PCTGISRLQRWERAALHGLNPPQEIKDILLKESTDLEYTQSLWCDYPL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgacacctaagcgtggactcataaccgacaccttcaaggttgtaaagaaggcaaggaga ggtggcaagagagacaagtctccttcaccaccagtagcagagcctgagcccccacaactg agtgaaagagaaaaagatctactagaactgaagaagttcgacctggactggaaattcgga ccatgcacagggatcagtcgactgcagagatgggagagggcagcactgcatgggctgaat cccccgcaggagattaaagacattttactgaaggagagcactgacctggagtacacacag agtctctggtgtgactatcccctctga

DBGET integrated database retrieval system