Garra rufa (doctor fish): 141342665 Help Entry 141342665         CDS       T11039                                  Symbol s100a10b Name (RefSeq) protein S100-A10b   KO K17274   protein S100-A10 Organism grf  Garra rufa (doctor fish) Pathway grf04382   Cornified envelope formation grf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:grf00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     141342665 (s100a10b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141342665 (s100a10b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141342665 (s100a10b) Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of microglial cells    141342665 (s100a10b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 Astro_p19 EF-hand_FSTL1 EF-hand_8 Motif Other DBs NCBI-GeneID:  141342665 NCBI-ProteinID:  XP_073703263 LinkDB All DBs Position 9:28012917..28014593 Genome browser AA seq 110 aa AA seqDB search MPSDLERAMETLITVFHRYASKESGNSSTLNRRELKMLMETELSSFLKSQKDPAAVDRIM RDLDSNFDGEVNFEEFVSLVVGLSIACEQLYQKQKQAQAQPQPGGCAKKQ NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgccttctgatctggaaagagcgatggagacgctgatcacagtgtttcaccgttatgca agcaaagagagtgggaattcatcaacactaaatcgcagagagctcaaaatgctgatggag acagaattgtccagctttctgaagtctcagaaggaccctgctgccgtagacaggattatg agggatttggatagtaattttgatggagaggtgaatttcgaggagtttgtgtctcttgtg gtgggcctgtccattgcctgcgaacagctctaccagaagcagaagcaggcgcaggcgcag ccgcagccgggaggatgtgccaaaaagcagtga

DBGET integrated database retrieval system