Garra rufa (doctor fish): 141342967 Help Entry 141342967         CDS       T11039                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism grf  Garra rufa (doctor fish) Pathway grf04010   MAPK signaling pathway grf04144   Endocytosis grf04370   VEGF signaling pathway grf04510   Focal adhesion grf04520   Adherens junction grf04530   Tight junction grf04810   Regulation of actin cytoskeleton grf04912   GnRH signaling pathway grf05100   Bacterial invasion of epithelial cells grf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:grf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     141342967 (cdc42l)    04370 VEGF signaling pathway     141342967 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141342967 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     141342967 (cdc42l)    04520 Adherens junction     141342967 (cdc42l)    04530 Tight junction     141342967 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     141342967 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     141342967 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141342967 (cdc42l)    05100 Bacterial invasion of epithelial cells     141342967 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:grf04131]     141342967 (cdc42l)    03036 Chromosome and associated proteins [BR:grf03036]     141342967 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:grf04147]     141342967 (cdc42l)    04031 GTP-binding proteins [BR:grf04031]     141342967 (cdc42l) Membrane trafficking [BR:grf04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     141342967 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     141342967 (cdc42l)   Macropinocytosis    Ras GTPases     141342967 (cdc42l) Chromosome and associated proteins [BR:grf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     141342967 (cdc42l) Exosome [BR:grf04147]  Exosomal proteins   Exosomal proteins of microglial cells    141342967 (cdc42l)   Exosomal proteins of breast milk    141342967 (cdc42l) GTP-binding proteins [BR:grf04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     141342967 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  141342967 NCBI-ProteinID:  XP_073703659 LinkDB All DBs Position 9:20086691..20095457 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgcctcctc atctcatatacaaccaacaaattcccctctgaatacgttcccacggtttttgataactat gctgtcacagtgatgattggaggtgaaccgtatacactggggctttttgacacagcaggt caggaagactacgacagacttcgacctctcagttatccacagacagatgtcttccttgtt tgcttctctgttgtttctccttcctcatttgagaatgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaggtcgacctgagg gatgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatatcgcccgag agcggggagaagctggccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggcctgaagaatgtattcgatgaggcgatactcgccgcccttgaacctccg gagaccaaacccaagaagcgctgcgtccttttgtag

DBGET integrated database retrieval system