Christiangramia salexigens: LPB144_03375 Help Entry LPB144_03375      CDS       T04586                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism grl  Christiangramia salexigens Pathway grl01100   Metabolic pathways grl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:grl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPB144_03375    00074 Mycolic acid biosynthesis     LPB144_03375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPB144_03375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  APG59507 UniProt:  A0A1L3J303 LinkDB All DBs Position 780634..780891 Genome browser AA seq 85 aa AA seqDB search MSNLHTQLKESIIEQLNLEDMEVSEISNDEPLFGDGLGLDSIDALELIVLLEKDYGIKLA DPQQGKEVFESINSMVDYIQKHRTK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtaacctgcatacccaacttaaagaaagtattattgaacaacttaacctcgaggat atggaggtgagtgagatttcgaatgacgaaccactatttggcgacggtcttggcttagat agtatagatgctctggaactaatcgttctcctagaaaaagattatggtattaaactagcc gatcctcagcaggggaaggaagtcttcgaatccattaatagtatggtggattacattcaa aagcatcgcaccaaataa

DBGET integrated database retrieval system