Granulicella sp. WH15: FTO74_03015 Help Entry FTO74_03015       CDS       T06415                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism grw  Granulicella sp. WH15 Pathway grw01100   Metabolic pathways grw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:grw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FTO74_03015    00074 Mycolic acid biosynthesis     FTO74_03015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FTO74_03015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QHN02455 UniProt:  A0A7L5A5I9 LinkDB All DBs Position complement(684034..684273) Genome browser AA seq 79 aa AA seqDB search MAAVDEKVKQIIVEQLQVDEAEVTPGASFQEDLGADSLDVVELVMQFEEAFDIQIPDEDA EKIKTVKDAVDYIEKNQKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcagcggtagacgaaaaagtaaaacagatcattgtcgagcagcttcaggtggatgag gccgaagtgacccccggcgcaagcttccaggaggacctcggagcagattcgctcgatgtc gtcgagctcgtcatgcagttcgaagaagccttcgacatccagattcccgacgaagacgcc gagaagatcaagaccgtcaaggacgctgtcgactacatcgagaagaaccagaagaagtaa

DBGET integrated database retrieval system