Granulicella sp. WH15: FTO74_05885 Help Entry FTO74_05885       CDS       T06415                                  Name (GenBank) histidine kinase   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism grw  Granulicella sp. WH15 Brite KEGG Orthology (KO) [BR:grw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:grw03000]     FTO74_05885    03036 Chromosome and associated proteins [BR:grw03036]     FTO74_05885    03400 DNA repair and recombination proteins [BR:grw03400]     FTO74_05885 Transcription factors [BR:grw03000]  Prokaryotic type   Helix-turn-helix    Other families     FTO74_05885 Chromosome and associated proteins [BR:grw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FTO74_05885 DNA repair and recombination proteins [BR:grw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       FTO74_05885 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HVO_A0261_N HTH_23 HTH_Crp_2 HTH_1 MobC_2 Phage_NinH Motif Other DBs NCBI-ProteinID:  QHN02950 LinkDB All DBs Position complement(1402753..1403034) Genome browser AA seq 93 aa AA seqDB search MKRELDSLITQMHSAGINYTDAVRQFKRRYILEVLAQHKGNQCKAATELGMHRNTLSRTL TELDLDTTQIRLGMRRPVVSERPRLTSNIASIR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt ttgaagcgcgaacttgacagcttgattacccagatgcacagcgccggaattaactacacg gacgcggttcgccagttcaagcggcgctacattctagaggtgctggcgcagcataagggc aaccagtgcaaggccgctaccgagcttgggatgcaccgcaatacgttgagccgtacgctc acggagttggaccttgacacgacccagatccgtctggggatgcgccgccctgtagtaagc gagcgcccccgcctgaccagcaacatagccagcatccgctag

DBGET integrated database retrieval system