Granulicella sp. WH15: FTO74_07020
Help
Entry
FTO74_07020 CDS
T06415
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
grw
Granulicella sp. WH15
Pathway
grw00061
Fatty acid biosynthesis
grw00620
Pyruvate metabolism
grw00640
Propanoate metabolism
grw00720
Other carbon fixation pathways
grw01100
Metabolic pathways
grw01110
Biosynthesis of secondary metabolites
grw01120
Microbial metabolism in diverse environments
grw01200
Carbon metabolism
grw01212
Fatty acid metabolism
Module
grw_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
grw00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
FTO74_07020 (accC)
00640 Propanoate metabolism
FTO74_07020 (accC)
09102 Energy metabolism
00720 Other carbon fixation pathways
FTO74_07020 (accC)
09103 Lipid metabolism
00061 Fatty acid biosynthesis
FTO74_07020 (accC)
Enzymes [BR:
grw01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
FTO74_07020 (accC)
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
FTO74_07020 (accC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
ATP-grasp_3
ATP-grasp_4
RimK
SUKH-3
SKA2
Motif
Other DBs
NCBI-ProteinID:
QHN03149
LinkDB
All DBs
Position
1690605..1691954
Genome browser
AA seq
449 aa
AA seq
DB search
MFRKVLIANRGEIALRVISACKEMGIRTVAVYSEADRNSLHVRFADEAICIGPPRSSESY
LNVPAVISAAEIADVDAIHPGYGLLSENANFAEVCRASNIKFIGPPPEVTRMMGEKSTAR
QTMKKAKVPILPGSDGIIEGKDEALAWAKSVGYPVILKAVAGGGGKGMRICRSAEELPAL
FDQASTEAVNSFGNGDLYMEKFIERPRHIEFQVLADEHGNVMSLGERECSIQRRHQKLIE
EAPSLQVSPKLRAELGKTIERSLKDIGYWNAGTIEFLMDEDGKIYFIEMNTRIQVEHCVT
EMVTGIDLVKAQLRIAAGEKLSDIITEPVTIRGHAIECRINAEHPEKFTPSAGKITAFNI
PGGNGVRVDTAQYSEGVVPPYYDSMIAKLICHGKDREEAMNKMQRALSQFVVQGIHTTIP
LHQKIFADEEFRSGSFDTKFMERFFERQK
NT seq
1350 nt
NT seq
+upstream
nt +downstream
nt
atgtttcgtaaggtattgattgcaaatcggggcgagatcgcgctacgggtcatcagcgcg
tgcaaggagatgggtatccggacggtggccgtttacagcgaggccgaccggaactcgcta
cacgtgcgcttcgccgatgaggccatctgcatcgggcctccgcgctcgtcggagagctac
ctgaacgtccccgcggtcatctcggctgccgagatcgccgacgtcgatgcgatccacccc
ggctatggcctgctgagcgagaacgccaacttcgccgaggtctgccgtgcgagcaacatc
aagttcatcggaccgccccccgaagtaacccggatgatgggcgagaagtccaccgcgcgc
cagaccatgaagaaggccaaggtgccgattcttcccgggtcggacggcatcatcgagggc
aaggacgaggcgctggcatgggccaagagtgtcggctacccggtcatcctgaaggcggtg
gcgggcggcggcggcaagggaatgagaatctgccgcagcgccgaggaacttccggccctc
ttcgatcaggcgtcgaccgaggcggtgaattcgttcggcaacggcgatctgtacatggag
aagttcatcgagcggcctcggcacatcgagtttcaggtgctggccgatgaacacggcaac
gtgatgagcctgggcgagcgagagtgctcgatccagcgccgccaccagaagctgatcgag
gaggccccgtcgctccaggtaagcccgaagctgcgcgccgaactgggcaagacgatcgag
cggtctctcaaggacatcggctactggaacgccggaaccatcgagttcctgatggacgag
gatggcaagatctacttcatcgagatgaacacccgtatccaggtcgagcattgtgtaacc
gagatggttacaggaatcgacctggtgaaggcgcagctcaggattgccgcgggtgagaag
ctcagcgatattatcaccgaaccggttacaattcgcgggcacgccatcgagtgccgcatc
aacgctgagcacccggagaagttcacgccgagcgcgggcaagatcacggcgttcaatatt
cccggaggaaacggcgtccgcgtggacacggcccagtactccgagggcgtggtgccgccg
tactacgactcgatgatcgccaagctgatctgccacggcaaggaccgcgaggaggccatg
aacaagatgcagcgggcgctcagccagttcgttgtgcagggaattcacacgacgattccg
ctgcaccagaagatcttcgccgatgaggagttccgctccggttcgttcgatacgaagttc
atggaacgcttctttgaacgccagaaatag
DBGET
integrated database retrieval system