Granulicella sp. WH15: FTO74_12710 Help Entry FTO74_12710       CDS       T06415                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism grw  Granulicella sp. WH15 Pathway grw01100   Metabolic pathways grw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:grw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FTO74_12710    00074 Mycolic acid biosynthesis     FTO74_12710   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FTO74_12710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QHN04131 LinkDB All DBs Position 3073033..3073332 Genome browser AA seq 99 aa AA seqDB search MNASTEPTLGTTDPDSVQGRVLRVVATSRRLPTESVTSDSTFEQLGIDSLDRINLLFDLE NEFDISIDDEEAKTITTIPQMVTGIQQLLQSKESGLASI NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacgcatccaccgaaccaacccttggcacgaccgatcccgactccgtccagggccgt gtcctccgagtcgttgccacctcacgccgccttcctaccgagtccgtcacctccgacagc accttcgagcagctcggcatcgactctctcgaccgcatcaatctgctcttcgacctcgag aacgagttcgacatctccatcgacgatgaggaggccaaaaccatcaccactattccccag atggtgaccggcatccagcagctactccagtccaaggagtccgggctggccagcatctag

DBGET integrated database retrieval system